DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and lipib

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:253 Identity:72/253 - (28%)
Similarity:107/253 - (42%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTE 186
            :.|||:|.:....:..|:..|......|.........:.|:|.:.||..|....| |..:..|| 
Zfish    65 QQPLFNVTRPTTFVIHGYRPTGAPPIWINHIVHLLAAQKDMNILVVDWNRGAANLNYLTAVANT- 128

  Fly   187 EIGENIALGLVKLLDLV-----PVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKP 246
               ...||.:.:.::.:     .:::|||||.|||||:.|..|..|    ...:.||||||||.|
Zfish   129 ---RGTALNITRFIESMEKEGASLDSIHLIGVSLGAHVAGFIGAML----GGRVGRITGLDPAGP 186

  Fly   247 CFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFY-------PGGMSPLAAGCFSVTCA 304
            .|........|...||.||||:|::....|.|...|.:|||       ||....:.:|.....|.
Zfish   187 MFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGGLDQPGCPKTIFSGKSYFVCD 251

  Fly   305 HARS-WEYFAE-------TVFP-GNERNFMATRCNSISKLRDFRCPGDEVPMGYAVPQ 353
            |.|| :.|...       |.:| .:..:|::.:|......:...||    .:||.:.|
Zfish   252 HQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQCETFKPASCP----VLGYDLSQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 72/253 (28%)
Pancreat_lipase_like 99..365 CDD:238363 72/253 (28%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 72/253 (28%)
Pancreat_lipase_like 40..324 CDD:238363 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.