DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and Pla1a

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:243 Identity:76/243 - (31%)
Similarity:106/243 - (43%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 AYLCRNDTNVLILDAANFIDTLYTWSALNTEV-----IGDYLAKALLRLNTSYVTKQFHLVGHSL 288
            |.|...|.||:.:|.......:| :||:...|     |..:|:| ||.|..|  ....|::|.||
Mouse   107 AVLRAADANVIAVDWVYGSTGVY-YSAVENVVKLSLEISRFLSK-LLELGVS--ESSIHIIGVSL 167

  Fly   289 GAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSK 353
            ||.:.|..|..|:    || |.:|||||||.|.:...:..|.|.:|||.||:.|||:....|...
Mouse   168 GAHVGGMVGHFYK----GQ-LGQITGLDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRI 227

  Fly   354 RAGDADFFVQGRIPFKPGCESL-----DPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELL 413
            ..|..|:||.|. ..:|||.:.     :.:.|.|.|||..:...:  .|....:|..|..|...|
Mouse   228 PVGHVDYFVNGG-QDQPGCPAFFHAGYNYLICDHMRAVHLYISAL--ENTCPLMAFPCASYKAFL 289

  Fly   414 LGNY--CKNTNTVMGYAAKATDLGLFYVGANPEEPYGQNANLQSYTNS 459
            .|:.  |.|.     :......:||...|....||..:...:...|.|
Mouse   290 AGDCLDCFNP-----FLLSCPRIGLVERGGVMIEPLPKEVKVYLLTTS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 72/225 (32%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.