DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:319 Identity:94/319 - (29%)
Similarity:136/319 - (42%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PDMSRMSFLLRSSDD-----CQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPV 226
            |:.....|||.::::     ....|.|||     ...:.|...|.|...|.|:   |:......|
  Rat    49 PEKINTRFLLYTNENPTAFQTLQLSDPLT-----IGASNFQVARKTRFIIHGF---IDKGEENWV 105

  Fly   227 AKAYLCRN-----DTNVLILDAANFIDTLYTWSALNTEVIGDYLAKA--LLRLNTSYVTKQFHLV 284
            ..  :|:|     :.|.:.:|......|.||.:|.|..|:|..:|:.  :|..|.||...:.||:
  Rat   106 VD--MCKNMFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLI 168

  Fly   285 GHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGM- 348
            ||||||.:||.||   .|..|   |.|||||||....|....|...|...||.|||:|||:... 
  Rat   169 GHSLGAHVAGEAG---SRTPG---LGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPL 227

  Fly   349 -----FGTSKRAGDADFFVQGRIPFKPGCE----------------SLDPISCSHQRAVDYWTET 392
                 |||::.:|..|||..|. ...|||:                :.|.::|:|.|:..|:.|:
  Rat   228 IPFLGFGTNQMSGHLDFFPNGG-QSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLES 291

  Fly   393 VYPSNGNDFLAKRCKRYSELLLGNYC-----KNTNTVMGYAAKATDLGLFYVGANPEEP 446
            :.  |.:.|.|..|..|.: ...|.|     :....:..||.|       :.|.:.:||
  Rat   292 IL--NPDGFAAYPCASYKD-FESNKCFPCPDQGCPQMGHYADK-------FAGKSGDEP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 91/309 (29%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 94/319 (29%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.