DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:276 Identity:90/276 - (32%)
Similarity:128/276 - (46%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KLIP----DMSRMSFLLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSG 224
            ||:|    |:. ..|||.::::..|..:...........:.|..||.|...|.|:.....:|...
Human    43 KLLPWSPEDID-TRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPS 106

  Fly   225 PVAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNT--SYVTKQFHLVGHS 287
            .:.|........|.:.:|..:....:||.:..|..|:|...|..:..|:|  .|..:..|::|||
Human   107 DMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHS 171

  Fly   288 LGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTN-----PG 347
            |||..|..||   ||| ||:: .||||||||.|||.|..|...|...||.|||:|||:     |.
Human   172 LGAHTAAEAG---RRL-GGRV-GRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPS 231

  Fly   348 M-FGTSKRAGDADFFVQGRIPFKPGCE--------SLDPI--------SCSHQRAVDYWTETVYP 395
            : ||.|::.|..|||..|.... |||:        .:|.|        ||:|.|:.:|::.:|. 
Human   232 LGFGMSQKVGHLDFFPNGGKEM-PGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVL- 294

  Fly   396 SNGNDFLAKRCKRYSE 411
             |.:.||...|..|.|
Human   295 -NPDGFLGYPCASYDE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 86/264 (33%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 90/276 (33%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 2/21 (10%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.