DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and PNLIP

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:308 Identity:91/308 - (29%)
Similarity:140/308 - (45%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FLLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRN---- 234
            |||.::::..|.......:..: :.:.|..:|.|...|.|:   |:......:|.  :|:|    
Human    55 FLLYTNENPNNFQEVAADSSSI-SGSNFKTNRKTRFIIHGF---IDKGEENWLAN--VCKNLFKV 113

  Fly   235 -DTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTS--YVTKQFHLVGHSLGAQIAGSA 296
             ..|.:.:|......|.||.::.|..::|..:|..:..|.::  |.....|::||||||..||.|
Human   114 ESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEA 178

  Fly   297 GRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTN-----PGM-FGTSKRA 355
            |   ||.:|  .:.||||||||.|||....||..|...||:|||:|||:     |.: ||.|:..
Human   179 G---RRTNG--TIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVV 238

  Fly   356 GDADFFVQGRIPFKPGCE--------SLDPI--------SCSHQRAVDYWTETVYPSNG------ 398
            |..|||..|.:.. |||:        .:|.|        :|:|.|:..|:|:::...:|      
Human   239 GHLDFFPNGGVEM-PGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPC 302

  Fly   399 ---NDFLAKRCKRYSE---LLLGNYCKNTNTVMGYAAKATDLG-LFYV 439
               |.|.|.:|.....   ..:|:|...      |..|..|:| .||:
Human   303 ASYNVFTANKCFPCPSGGCPQMGHYADR------YPGKTNDVGQKFYL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 91/308 (30%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 91/308 (30%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.