DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG6277

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:287 Identity:96/287 - (33%)
Similarity:132/287 - (45%) Gaps:31/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FLLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNV 238
            :|..||:..:...|  |.:.:..:.:.|....||...|.|||.|...|.:..:..|:|.|.|.||
  Fly    71 YLYTSSNPTKGKKI--TASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDYNV 133

  Fly   239 LILDAANFIDTLYTWSALNTEVIGDYLAKAL--------LRLNTSYVTKQFHLVGHSLGAQIAGS 295
            :::|.|......|..|.|.....|..:||.:        |.||..||      :||||||.:||.
  Fly   134 IVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYV------IGHSLGAHVAGY 192

  Fly   296 AGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADF 360
            ||:|    :.||: ..|.|||||.|.|......:.|.|.||.:|:.|.||.|..|..|..|...|
  Fly   193 AGKN----TDGQV-HTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAF 252

  Fly   361 FVQGRIPFKPGCESLDPI-SCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNT--N 422
            :..|. ..:||| .||.. :|||.|:..|:.|.|...|   |...:|..|.| .:...|.:|  :
  Fly   253 YPNGG-KTQPGC-GLDLTGACSHGRSTTYYAEAVSEDN---FGTMKCGDYEE-AVSKECGSTYSS 311

  Fly   423 TVMGYAAKATDL-GLFYVGANPEEPYG 448
            ..||....|..: |.:||..|.:.|:|
  Fly   312 VRMGADTNAYMVEGDYYVPVNSKAPFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 93/280 (33%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 93/280 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.