DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG6295

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:254 Identity:83/254 - (32%)
Similarity:122/254 - (48%) Gaps:16/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILD--AANFIDTLYTWSALNTEVIGD 263
            |..:.||...|.||::|.:...:..|..|:....|.|::.:|  .|..:|  |..|.|....:|:
  Fly    92 FNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDWGRARSVD--YASSVLAVPGVGE 154

  Fly   264 YLAKAL--LRLNTSYVTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGN 326
            .:|..:  :|.|.........::||||||.::|.||:|   :..|| |..|.|||||.|.|...:
  Fly   155 QVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKN---VKNGQ-LHTIIGLDPALPLFSYDS 215

  Fly   327 ELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIPFKPGCESLDPISCSHQRAVDYWTE 391
            ..:.|.|.||.:|:.|.||.|..|..|..|...|:..|. ..:|||......||:|.|:|.|:.|
  Fly   216 PNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGG-KSQPGCGVDLTGSCAHSRSVIYYAE 279

  Fly   392 TVYPSNGNDFLAKRCKRYSELLLGNYCKNTNTV-MGYAAKATDL-GLFYVGANPEEPYG 448
            :|   ..|:|...||..|.|.:......:.::| ||....|..: |.:||....:.|||
  Fly   280 SV---TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 80/247 (32%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.