DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and lipca

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:301 Identity:88/301 - (29%)
Similarity:124/301 - (41%) Gaps:65/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 SSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWT------------TSINNSNSGPVAKAY 230
            :.|.|   ::.|.|...| :..||....|..:.|.||:            .|...|:.|.:    
Zfish    55 TEDTC---ALELFQPHTL-DACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKSSEGNI---- 111

  Fly   231 LCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTSYVTKQF-----HLVGHSLGA 290
                  ||||.|........|..:|.||.::|..:|..|..|..   .|||     ||:|:||||
Zfish   112 ------NVLIADWLTLAHQHYPIAAQNTRIVGQDIAHLLSWLED---FKQFPLGKVHLIGYSLGA 167

  Fly   291 QIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHT----NPGM-FG 350
            .|:|.||.|.  ...|:.|.||||||||.|.|...:..:.|...||:|||.|||    ..|: .|
Zfish   168 HISGFAGSNL--AMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVG 230

  Fly   351 TSKRAGDADFFVQGRIPFKPGCE-----------------SLDPISCSHQRAVDYWTETVYPSNG 398
            ..:.....||:..|. .|:|||:                 ....:.|:|:|||..:.:::. :..
Zfish   231 IKQPVAHFDFYPNGG-SFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLL-NKD 293

  Fly   399 NDFLAKRCKRYSELLLGNYC----KNTNTVMGYAAKATDLG 435
            ...:|.:|...:....|| |    ||....:||..|....|
Zfish   294 KQIMAYKCSDNTAFDKGN-CLDCRKNRCNTLGYDIKKVRTG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 88/301 (29%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 88/301 (29%)
Pancreat_lipase_like 54..344 CDD:238363 88/301 (29%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.