DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and lipg

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:275 Identity:76/275 - (27%)
Similarity:120/275 - (43%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GFYQDRPTVLFITGWTTS--INNSNSGPVAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIG 262
            ||.....|:|.|.|||.|  ..:.....||......::.||:::|.....:.||..:..:|..:|
Zfish    82 GFNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAVNHTRRVG 146

  Fly   263 DYLAKAL--LRLNTSYVTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDG 325
            ..:|..|  |:.......:..|::|:||||.:||.||.....:.|     ||||||||.|.|...
Zfish   147 QSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGIIG-----RITGLDPAGPMFEGA 206

  Fly   326 NELEGLRSGDARFVDIIHT-NPGMFGTS----KRAGDADFFVQGRIPFKPGC-----------ES 374
            :....|...||.|||::|| ..|..|.|    :..|..|.:..|. ..:|||           ..
Zfish   207 DSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGG-DVQPGCTFGEFLSAASGNF 270

  Fly   375 LDPISCSHQRAVDYWTETVYPSNGNDFLAKRC---KRYSELLLGNYCKNTNTVMGYAAKATDL-- 434
            ::.:.|.|:|||..:.:::...:...: |.:|   .|:.:.:..:..||....:||.||....  
Zfish   271 MEAMKCEHERAVHLFVDSLMNKDHVSY-AFQCTGPDRFKKGICLSCRKNRCNSIGYNAKKMRKRR 334

  Fly   435 -GLFYVGANPEEPYG 448
             ...|:....:.|:|
Zfish   335 NSKMYLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 74/268 (28%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 76/275 (28%)
Pancreat_lipase_like 65..344 CDD:238363 74/268 (28%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.