DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG10163

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:373 Identity:85/373 - (22%)
Similarity:150/373 - (40%) Gaps:76/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LDDSESLKLARPAS--SYQEALLNRLQDQLNQFVVGLPLDLGFSTLNYICSTIVDLGVVR--SKL 165
            ::|.:  |...|.:  |.|:..:..|.:|||:         |:..   .|...||.||:.  ..:
  Fly    27 VEDKD--KATNPLNIDSVQKHNVKLLSEQLNR---------GWRA---FCDAPVDEGVMSLFQGI 77

  Fly   166 IPDMSRMSFLLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTS------------I 218
            .|..:|:..:..::   |:..:|:....|: .......:|.|::::..:.|:            :
  Fly    78 NPSDARLHVMTITN---QSVELPIKSISQI-KDFDINPERKTLIYVNAFHTADSYFSVQEHLTLL 138

  Fly   219 NNSNSGPVAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTSYVTKQ-FH 282
            .||           |.|.||:::|.|..:..||.....:..|.|.::.|.|..|..:.:..| ..
  Fly   139 QNS-----------RRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDAGIAVQDIT 192

  Fly   283 LVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGD-------ARFVD 340
            |.|||:||.||....:.:.: ...|::.::..:|||..|          |:.|       |..|.
  Fly   193 LAGHSVGANIAALGAQLFAK-ENKQLVGQLLAIDPATMC----------RTTDILVKQSVALRVV 246

  Fly   341 IIHTNPGMFGTSKRAGDADFFVQG-----RIPFKPGCESLDPISCSHQRAVDYWTETVYPSNGND 400
            ::|....:||.....|..|.:..|     |...:|||||.   .|||......:.|.:.  .|..
  Fly   247 VLHGEGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESK---ICSHMYPFILFMEALI--EGVM 306

  Fly   401 FLAKRCKRYSELLLGNYCKNTNTV-MGYAAKATDLGLFYVGANPEEPY 447
            ..|.:|:.:::...|: |...||: :|....|...||::....|..|:
  Fly   307 IPATKCESWAKFRQGD-CNFQNTINIGLIYPANAKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 66/296 (22%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 66/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.