DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG6675

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:407 Identity:114/407 - (28%)
Similarity:170/407 - (41%) Gaps:97/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PDADVLRNKTTEGL-----ISLNNKAENTMTGLDDSESLKLARPASSYQEA---LLNRLQDQLNQ 134
            |:.|    .|..||     ||...:.::.:..|||           .|:||   :.|.....|::
  Fly    39 PNLD----DTPYGLGQRSDISTEPEEDDILASLDD-----------EYEEAKHCVWNTCDKDLSE 88

  Fly   135 F-VVGLPLDLGFSTLNYICSTIVDLGVVRSKLIPDMSRMSFLL--RSSDDC---QNTSIPLTQAE 193
            . .:|..|||.|  :..|.|.:...|   ||.:    ||.|.|  |...:|   .:.||     |
  Fly    89 SRGIGKFLDLPF--IKKIASNLNPFG---SKKL----RMHFYLFKREFPECGREVDFSI-----E 139

  Fly   194 QLWNTTGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILDAANFIDTLYTWSALNT 258
            :.|...||....||.|.|.||.:....|.:..|..|||.:.:.||:::|          |||.:.
  Fly   140 RKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNVIVVD----------WSASSA 194

  Fly   259 -----------EVIGDYLAKALLRLNTSYVTKQF-------HLVGHSLGAQIAGSAGRNYRRLSG 305
                       |..|..||:.:..||     :||       :|:|||||||||||||:..:.:. 
  Fly   195 NINYFSVVKLIETFGAELAQFIRNLN-----RQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVK- 253

  Fly   306 GQILKRITGLDPANPCF-YDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIP-- 367
               :..|..||||.|.| :.|.|.. :...||::|:.:||:.. ||..:..|.|.|:     |  
  Fly   254 ---VNTIFALDPAGPKFRHRGTEFR-IDPSDAKYVESMHTSAN-FGFRRPTGSATFY-----PNY 308

  Fly   368 --FKPGCESLDPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNTNTVMGYAAK 430
              ::..|..|   .|||.|:...:.|::....|  |....|.|.:.....:|.:..:..|.....
  Fly   309 GAYQHSCYYL---GCSHIRSYQMFAESINSPLG--FWGTPCIRDNGRWQCDYSQRQSIQMAGEPS 368

  Fly   431 ATDLGLFYVGANPEEPY 447
            ....|:|||..:..:|:
  Fly   369 IHKEGIFYVKTSSSDPF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 87/298 (29%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 88/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.