DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG13282

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:284 Identity:89/284 - (31%)
Similarity:132/284 - (46%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 TTGFYQDR-PTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILDAANFIDTLYTWSAL----- 256
            |..::..| ||.:.|.|:.:.:.......:.:.||.:.|.|::.:|          ||.|     
  Fly   105 TDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKADYNIIYVD----------WSILSPGPC 159

  Fly   257 ------NTEVIGDYLAKALLRL----NTSYVTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKR 311
                  ||:..|...|:.:.||    ||     ..|::|.|||||:.....||....    :|.|
  Fly   160 YISAVHNTKHAGTCTAQLVERLVETGNT-----DIHVIGFSLGAQVPNYIARNLSSF----MLPR 215

  Fly   312 ITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIPFKPGC--ES 374
            |||||||.|.|....:.:.|...||.:||:||||..:.|..:|.|.|||::.|.| .:|||  :.
  Fly   216 ITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNGGI-MQPGCNGQK 279

  Fly   375 LDPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNTNTVM--GYAAKATDLGLF 437
            ::..:||||||..|:.|::....|  |....|..|...||| .|..||.::  |...:.|..|:|
  Fly   280 INSFACSHQRAPAYFLESIRSPKG--FWGWACSGYISYLLG-MCPPTNFLLEAGENIRPTTRGMF 341

  Fly   438 YVGANPEEPYGQNANLQSYTNSDT 461
            .:..|...|:.    |..:|:..|
  Fly   342 MIDTNDSSPFA----LGKWTDLPT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 84/264 (32%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 85/268 (32%)
Pancreat_lipase_like 75..347 CDD:238363 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.