DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG6431

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:295 Identity:80/295 - (27%)
Similarity:113/295 - (38%) Gaps:75/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MSFLLRSSDDCQNTSIPLTQAEQLWNTT--------------------------------GFYQD 204
            :.||||:.:...|   ||.....||.|.                                ||.:.
  Fly    32 LQFLLRNGNFDLN---PLNCHILLWETCPKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKH 93

  Fly   205 RPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILDAANFID-TLYTWSALNTEVIGDYLAKA 268
            |.||..|.|:..:..:.:...:..|||.| |.||:.:|...... ..|..|.:||.:.....|:.
  Fly    94 RETVFIIHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQI 157

  Fly   269 LLRLNTSY--VTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGL 331
            ...| |.|  |.::...|||||||.|.|....:..|..     .||.|||||.|.      :|.:
  Fly   158 YAFL-THYGAVRERITCVGHSLGAHICGMISNHLTRKQ-----YRIIGLDPARPL------IERM 210

  Fly   332 RSG-------DARFVDIIHTNPGMFGTSKRAGDADFFVQ-GRIPFKPGCESLDPI---SCSHQRA 385
            :|.       ||..:.::|||.|..|....:|..::.|. |||  :|.|:. :||   .|||..:
  Fly   211 KSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRI--QPFCKG-NPIRKSRCSHFLS 272

  Fly   386 VDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKN 420
            :.|.....:  ..|.|:...|.        |.|.|
  Fly   273 ICYLATATF--KHNKFMGVPCP--------NGCLN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 80/295 (27%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.