DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG7367

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:355 Identity:107/355 - (30%)
Similarity:149/355 - (41%) Gaps:48/355 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EALLNRLQDQLNQFVVGLPLDLGFSTLNYICSTIVDLGVVRSKLIPDMSRMSFLLRSSD------ 180
            |..||  |:..|:..:.:|...|...:.|:.....:..:...:||      .|.|..||      
  Fly    53 EVALN--QEDYNKTWIYMPNGQGKPEVAYLVEPPPENRINLPQLI------KFELYGSDSSSSAD 109

  Fly   181 ---DCQNTSIPLTQAEQLWNTTG--FYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLI 240
               |..|...|.......|....  |..:..|.:.:.||.:|..:::...:..||:.|...||..
  Fly   110 FWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSIRGAYIERGQVNVFA 174

  Fly   241 LDAANFIDTLYTWS-ALNTEVIGDYLAKA--LLRLNTSYVTKQFHLVGHSLGAQIAGSAG--RNY 300
            ::..:..|.:|..: |..|..:|..:||.  ||.........:.||:||||||.|.|.||  ..|
  Fly   175 INWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKY 239

  Fly   301 RRLSGGQILKRITGLDPANPCFYD--GNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQ 363
            |       :.||||||||.|.|.|  |.| ..|...||.|||:||:..|..|..|..|..||:..
  Fly   240 R-------VNRITGLDPARPAFEDCIGPE-NHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPN 296

  Fly   364 GRIPFKPGCESLDPI--SCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNTNTVMG 426
            |..|.:|||:.|..|  .|||.|:.:|:.|::....|  |....|....| |.|..|.....:||
  Fly   297 GGGPPQPGCKELSQIFTGCSHGRSYEYYAESINSPKG--FYGVPCSGLDE-LKGKNCTGGKILMG 358

  Fly   427 YAAKATDLGLFYVGANPEEPYGQNANLQSY 456
            ........|:|:|         :.||..||
  Fly   359 DPVPREARGIFFV---------KTANKPSY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 93/290 (32%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 88/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.