DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and CG4267

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:356 Identity:102/356 - (28%)
Similarity:145/356 - (40%) Gaps:78/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 STLNYICSTIVDLGVVRS-------KLIPDMS---RMSFLLRSSD--DCQNTSIPLTQAEQLWNT 198
            :|.||.......|||..|       .|||..|   :|.|:|...|  || ...:.:...|.|.| 
  Fly    36 ATCNYTLVKKKTLGVDPSFWKKFFKHLIPFTSSRGKMQFILFKRDFADC-GRELFVGDVENLRN- 98

  Fly   199 TGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDT------------NVLILDAANFIDTLY 251
            :||.....|.:.|.||.:....|:...|..|||...|.            ||::.|         
  Fly    99 SGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCD--------- 154

  Fly   252 TWSALNTEVIGDYLAK------ALLRLNTSYVTKQ-------FHLVGHSLGAQIAGSAGRN---Y 300
             ||..:|.|....:||      |||.....|:.::       .:::|||||||||||||:.   |
  Fly   155 -WSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPY 218

  Fly   301 RRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGR 365
            |       ...|..||||.|.|.:.::...:.:.||.:|:.|.|:.. ||..:..|.|.|:..  
  Fly   219 R-------FNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVS-FGFEQPVGHATFYPN-- 273

  Fly   366 IPFKPGCESLDPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSE---LLL---GNYCKNTNTV 424
              :....:......|||:|:.||:.|::....|  |...||:|:.:   |||   |.:      .
  Fly   274 --YGKNQKKCYVYGCSHKRSHDYFIESLTSPAG--FWGPRCERHDDGTWLLLMSDGEF------R 328

  Fly   425 MGYAAKATDLGLFYVGANPEEPYGQNANLQS 455
            ||........|.|||....:.||......|:
  Fly   329 MGGEPSIPKNGTFYVKTYSKPPYAMGHRWQT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 88/306 (29%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 90/318 (28%)
Pancreat_lipase_like 71..347 CDD:238363 88/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.