DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and pla1a

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:293 Identity:84/293 - (28%)
Similarity:122/293 - (41%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSN--SGPVAKAYLCRNDTNVLIL 241
            :.||.|.    ||.    :|..|....||.:.:.|:....:..:  || :|:|.|...|.|||::
Zfish    67 TQDCLNH----TQK----HTAYFNSSLPTKVIVHGYRALGSKPSWVSG-LAQALLREEDVNVLVV 122

  Fly   242 D-------AANFIDTLYTWSALNTEVIGDYLAKALLRLNTSYVTKQFHLVGHSLGAQIAGSAGRN 299
            |       |.|.:...|...|:...|:.:.|.|      .....:.||.:|.||||.::|..|..
Zfish   123 DWVYGASFAYNLVVENYKEVAVQISVLINQLTK------YGSTLESFHFIGVSLGAHVSGFVGTL 181

  Fly   300 YRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQG 364
            :....|     ||||||||.|.|...:..:.|.|.||.||:.|||:...||.|...|..|||:.|
Zfish   182 FHGKLG-----RITGLDPAGPMFKSADPFDRLDSSDALFVEAIHTDSDYFGISIPVGHVDFFLNG 241

  Fly   365 RIPFKPGC------ESLDPISCSHQRAVDYWTETV--------YPSNG-NDFLAKRCKRYSELLL 414
            .:. :.||      .....:.|.|.||:..:...:        :|.:| .:|||.:|....:...
Zfish   242 GMD-QAGCARSRFASMYGYVICDHMRALHVYMSALNGSCPLIGFPCSGYEEFLAGKCITCDDPFN 305

  Fly   415 GNYCKNTNTVMGYAAKATDLGLFYVGANPEEPY 447
            |. |.....:......||.|      .|.|:.|
Zfish   306 GT-CPQIGLLKNSGITATPL------PNQEKVY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 81/287 (28%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 84/293 (29%)
Pancreat_lipase_like 48..336 CDD:238363 84/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.