DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and lpl

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:256 Identity:76/256 - (29%)
Similarity:118/256 - (46%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FYQDRPTVLFITGWTTSINNSNSGP--VAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIGD 263
            |..:..|.:.|.|||.:....:..|  |...|......||:::|..:.....|..||..|:::|.
Zfish    88 FNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTSASYTKLVGK 152

  Fly   264 YLAKAL--LRLNTSYVTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGN 326
            .:||.:  |:....|..::.||:|:||||.:||.||     |.....:.||||:|||.|.|...:
Zfish   153 DVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAG-----LLTKHKVNRITGMDPAGPTFEYAD 212

  Fly   327 ELEGLRSGDARFVDIIHTN-----PGMFGTSKRAGDADFFVQGRIPFKPGCE------------- 373
            .|..|...||.|||::|||     ....|..:..|..|.:..|. .|:|||:             
Zfish   213 SLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGG-TFQPGCDLQNTMLMVATTGL 276

  Fly   374 -SLDPI-SCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYC----KNTNTVMGYA 428
             ::|.| .|||:|::..:.:::. :..::.:|.||........| .|    ||....:|||
Zfish   277 RNMDQIVKCSHERSIHLFIDSLV-NQDHESMAFRCSSRDSFNKG-MCLSCRKNRCNKVGYA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 76/256 (30%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 76/256 (30%)
Pancreat_lipase_like 56..353 CDD:238363 76/256 (30%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.