DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and Lipi

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:279 Identity:86/279 - (30%)
Similarity:130/279 - (46%) Gaps:43/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPV-----AKAYLCRN 234
            ||..|.:....:.||.::....|.. |...:.|:..|.|:    ....|.|:     .||:|.:.
  Rat    61 LLMYSRNNAKCAEPLFESNNSVNAR-FNPSKKTIWIIHGY----RPLGSTPMWIHKFTKAFLKQE 120

  Fly   235 DTNVLILD----AANFIDTLYTWSALNT----EVIGDYLAKALLRLNTSYVTKQFHLVGHSLGAQ 291
            |.|::::|    |..||   |..:..||    |::.:|:...|:.   ......||.:|.||||.
  Rat   121 DVNLIVVDWNQGATTFI---YGRAVKNTRKVAEILREYIENLLIH---GASLDNFHFIGMSLGAH 179

  Fly   292 IAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGMFGTSKRAG 356
            |.|..|:.::    || |.||||||||.|.|........|...||:|||:||::...||..:.:|
  Rat   180 ICGFVGKLFQ----GQ-LGRITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSG 239

  Fly   357 DADFFVQGRIPFKPGC-----ESLDPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSE----- 411
            ..||:..|. ..:|||     ..:|.|.|.|||||..:.| .:.:|.| |::..|:.|.:     
  Rat   240 HIDFYPNGG-RNQPGCPTSLLSGMDYIKCDHQRAVHLFLE-AFETNCN-FVSFPCRSYRDYKSGL 301

  Fly   412 -LLLGNYCKNTNTVMGYAA 429
             :..||..|::...:|..|
  Rat   302 CVGCGNLYKDSCPRLGIQA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 86/279 (31%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 86/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.