DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and LIPH

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:303 Identity:84/303 - (27%)
Similarity:121/303 - (39%) Gaps:73/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PDMSRMSFLLRSSDDCQNTSIPLTQAEQLW-----NTTGFYQDRPTVLFITGWTTSI----NNSN 222
            |..:|:||.........|..:.|...:.|.     |::.|..     |.:|..||.|    ..:.
Human    23 PSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGN-----LNVTKKTTFIVHGFRPTG 82

  Fly   223 SGPV-----AKAYLCRNDTNVLILDAANFIDTL-YTWSALNTEVIGDYLAKALLRLNTSYVTKQF 281
            |.||     .|..|...|.||:::|......|| ||.::..|..:             :.|.|:|
Human    83 SPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKV-------------AMVLKEF 134

  Fly   282 --------------HLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLR 332
                          :::|.||||.|:|..|..|....|     ||||||||.|.|......:.|.
Human   135 IDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGWLG-----RITGLDPAGPLFNGKPHQDRLD 194

  Fly   333 SGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIPFKPGCE-----SLDPISCSHQRAV------ 386
            ..||:|||:||::....|..:..|:.||:..|.:. :|||.     ......|.|||:|      
Human   195 PSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLD-QPGCPKTILGGFQYFKCDHQRSVYLYLSS 258

  Fly   387 --DYWTETVYPSNG-NDFLAKRC------KRYSELLLGNYCKN 420
              :..|.|.||.:. .|:...:|      ::.|..|||.|..|
Human   259 LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADN 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 82/298 (28%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 80/287 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.