DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:286 Identity:91/286 - (31%)
Similarity:130/286 - (45%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GVVR--SKLIP----DMSRMSFLLRSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTS 217
            |:::  ||:.|    |:. ..|||.::::..|..|.........|.:.|..||.|...|.|:   
Mouse    49 GMIQRPSKIFPWSPEDID-TRFLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHGF--- 109

  Fly   218 INNSNSG---PVAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNT--SYV 277
            |:....|   .:.|........|.:.:|......|.||.::.||.|:|..:|..:..|:|  .|.
Mouse   110 IDKGEEGWLLDMCKKMFQVEKVNCICVDWKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYS 174

  Fly   278 TKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDII 342
            .:..||:|||||:.:||.||   |||.|.  :.||||||||.|||....|...|...||.|||:|
Mouse   175 PENVHLIGHSLGSHVAGEAG---RRLEGH--VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVI 234

  Fly   343 HTNPGM------FGTSKRAGDADFFVQGRIPFKPGCES--LDPI--------------SCSHQRA 385
            ||:...      ||.|::.|..|||..|.... |||:.  |..|              :|:|.|:
Mouse   235 HTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEM-PGCQKNILSTIVDINGIWEGTRNFAACNHLRS 298

  Fly   386 VDYWTETVYPSNGNDFLAKRCKRYSE 411
            ..|:..::.  |.:.||...|..|.:
Mouse   299 YKYYASSIL--NPDGFLGYPCSSYEK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 86/267 (32%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 91/286 (32%)
Pancreat_lipase_like 65..363 CDD:238363 86/270 (32%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 4/14 (29%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 2/21 (10%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.