DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:332 Identity:99/332 - (29%)
Similarity:138/332 - (41%) Gaps:59/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DQLNQFVVGLPLDLGFSTLNYICSTIVDLGVVRSKLIPDMSRMSFLL---RSSDDCQNTSIPLTQ 191
            ::|..|..|||....|||           .:|.....|:.....|||   .:.:..|..|...:.
Human    23 ERLGCFKDGLPWTRTFST-----------ELVGLPWSPEKINTRFLLYTIHNPNAYQEISAVNSS 76

  Fly   192 AEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILDAANFIDTLYTWSAL 256
            ..|   .:.|..|:.|.:.|.||.|  :......:....|...|.|.:.||..|. ...|..:..
Human    77 TIQ---ASYFGTDKITRINIAGWKT--DGKWQRDMCNVLLQLEDINCINLDWING-SREYIHAVN 135

  Fly   257 NTEVIG---DYLAKALLRLNTSYVTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPA 318
            |..|:|   .|....|:: ...|...:.||:||||||.:||.||   .|:.|   |.||||||||
Human   136 NLRVVGAEVAYFIDVLMK-KFEYSPSKVHLIGHSLGAHLAGEAG---SRIPG---LGRITGLDPA 193

  Fly   319 NPCFYDGNELEGLRSGDARFVDIIHTNPGMF------GTSKRAGDADFFVQGRIPFKPGCESL-D 376
            .|.|::..:...|...||.|||:||||....      ||....|..||:..|. ...||||.| .
Human   194 GPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGG-KHMPGCEDLIT 257

  Fly   377 PI----------------SCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGN--YC-KNTN 422
            |:                .|:|.|:..::.|::.  |.:.|:|..|:.|:....||  :| |...
Human   258 PLLKFNFNAYKKEMASFFDCNHARSYQFYAESIL--NPDAFIAYPCRSYTSFKAGNCFFCSKEGC 320

  Fly   423 TVMGYAA 429
            ..||:.|
Human   321 PTMGHFA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 89/290 (31%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 99/332 (30%)
Pancreat_lipase_like 52..348 CDD:238363 89/292 (30%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.