DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:123/266 - (46%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FLLRSSDDCQN-TSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSG---PVAKAYLCRN 234
            |||.::::..| ..|..|:.:.: ..:.|..||.|...:.|:   |:....|   .:.|......
  Rat    69 FLLYTNENPNNYQKISATEPDTI-KFSNFQLDRKTRFIVHGF---IDKGEDGWLLDMCKKMFQVE 129

  Fly   235 DTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNT--SYVTKQFHLVGHSLGAQIAGSAG 297
            ..|.:.:|......|.||.::.||.|:|..:|..:..|:|  .|..:..||:||||||.:.|.||
  Rat   130 KVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAG 194

  Fly   298 RNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGM------FGTSKRAG 356
               |||.|.  :.||||||||.|||....|...|...||.|||:|||:...      ||.|::.|
  Rat   195 ---RRLEGH--VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVG 254

  Fly   357 DADFFVQGRIPFKPGCE----------------SLDPISCSHQRAVDYWTETVYPSNGNDFLAKR 405
            ..|||..|.... |||:                :.:.::|:|.|:..|:..::.  |.:.||...
  Rat   255 HLDFFPNGGKEM-PGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSIL--NPDGFLGYP 316

  Fly   406 CKRYSE 411
            |..|.:
  Rat   317 CSSYEK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 83/266 (31%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 83/266 (31%)
Pancreat_lipase_like 65..363 CDD:238363 83/266 (31%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.