DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and LOC100331214

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:327 Identity:97/327 - (29%)
Similarity:145/327 - (44%) Gaps:83/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 IPDMSRMS--FLLR--SSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTS--INNSNSG 224
            :.|:.:::  |.||  |..|.....|...:||.| ::..|.....|:|.|.|||.|  ..:....
Zfish    45 LSDVKKLNVKFSLRNPSQPDDDVCYIVRGKAETL-SSCNFNHTSKTILVIHGWTVSGLFESWVEK 108

  Fly   225 PVAKAYLCRNDTNVLILDAANFIDTL---YTWSALNTEVIG-------DYLAKALLRLNTSYV-T 278
            .||..|....|.||:::|   ::||.   |..:|.||:::|       |::.:      ||.| .
Zfish   109 LVAALYNREKDANVIVVD---WLDTAQDHYVVAAQNTKMVGREIGLFIDWIEE------TSNVPL 164

  Fly   279 KQFHLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEG-LRSGDARFVDII 342
            :..||:|:||||.:||.||.:.....|     ||||||||.|.| :|....| |...||.|||::
Zfish   165 ENLHLIGYSLGAHVAGFAGSHTTNKIG-----RITGLDPAGPDF-EGVHAHGRLSPDDAHFVDVL 223

  Fly   343 HT-NPGMFGTS----KRAGDADFFVQGRIPFKPGC------ESL---------DPISCSHQRAVD 387
            || ..|..|.|    :..|..|.:..|. .|:|||      |.:         :.|.|.|:|::.
Zfish   224 HTFTRGSLGLSIGIEQPVGHVDIYPNGG-SFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIH 287

  Fly   388 YWTETV---------YPSNGNDFLAK----RCKRYSELLLGNYCKNTNTVMGY----AAKATDLG 435
            .:.:::         |....||...:    :|::       |.|   ||| ||    ..||..:.
Zfish   288 LFIDSLLNEEAAGRAYSCGSNDMFDRGVCLQCRK-------NGC---NTV-GYDISKVRKARSVK 341

  Fly   436 LF 437
            :|
Zfish   342 MF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 96/321 (30%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 97/325 (30%)
Pancreat_lipase_like 51..347 CDD:238363 96/321 (30%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.