DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and lipc

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001107731.1 Gene:lipc / 100135730 XenbaseID:XB-GENE-955547 Length:496 Species:Xenopus tropicalis


Alignment Length:287 Identity:88/287 - (30%)
Similarity:134/287 - (46%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 RSKLIPDMSRMSFLL----RSSDDCQNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTT-SINNS 221
            |.|...|:....|.|    |..|.||   |.:.|.|.| ....|.:..|.|:.|.||:. .:..|
 Frog    38 RIKKHQDIPETKFKLYEEGRDEDLCQ---IQIFQPETL-EKCSFNESLPLVIIIHGWSVDGMLES 98

  Fly   222 NSGPVAKAYLC-RNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTS--YVTKQFHL 283
            ....:|.|:.. :...||::.|...|....|..:..||.:||..:|:.|..|.:|  :.....||
 Frog    99 WIWKMASAFKSQKRQVNVIVADWLTFAHVHYPIAVQNTRIIGLEIAEFLEWLESSIQFPRSNIHL 163

  Fly   284 VGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHT---- 344
            :|:||||.::|.|| :|  :||.:.:.||||||||.|.|...:..:.|...||.|||.|||    
 Frog   164 IGYSLGAHVSGFAG-SY--ISGLKKIGRITGLDPAGPLFEGMSSTDRLSPDDANFVDAIHTFTQQ 225

  Fly   345 NPGM-FGTSKRAGDADFFVQGRIPFKPGCE------------SLDPISCSHQRAVDYWTETVYPS 396
            :.|: .|.::.....||:..|. .|:|||:            ..:.:.|:|:|:|..:.:::.  
 Frog   226 HMGLSVGINQPVAHYDFYPNGG-HFQPGCDIKNLIANIGFYGIKETVKCAHERSVHLFIDSLL-- 287

  Fly   397 NGNDFLAKRCKRYSELLLGNYCKNTNT 423
              ||  .|:...|       :||:.||
 Frog   288 --ND--DKQSMAY-------WCKDINT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 85/277 (31%)
lipcNP_001107731.1 lipo_lipase 47..492 CDD:132274 85/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.