DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18258 and lpl

DIOPT Version :9

Sequence 1:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis


Alignment Length:303 Identity:86/303 - (28%)
Similarity:130/303 - (42%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DLGVVRSKLIPDMSRMSFLLRSSDDCQNTSIPLTQA-EQLWNTTGFYQDRPTVLFITGWTTSINN 220
            |...:.||         |.||:.::..:.:..|... |...:...|.....|.:.|.|||.:...
 Frog    41 DFNSIESK---------FSLRTLEEPDDDTCYLVPGQEHTVDQCNFNHTSKTFVVIHGWTVTGMF 96

  Fly   221 SNSGP--VAKAYLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTS--YVTKQF 281
            .:..|  |...|....|:||:::|........|..||..|:::|..:|..:..::.:  |.....
 Frog    97 ESWVPKLVDALYKREPDSNVIVVDWLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQYPIDNI 161

  Fly   282 HLVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHT-- 344
            |::|:||||..||.||    .|:..:: .||||||||.|.|........|...||.|||::||  
 Frog   162 HILGYSLGAHAAGVAG----SLTNKKV-NRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTYT 221

  Fly   345 --NPG-MFGTSKRAGDADFFVQGRIPFKPGC---ESL------------DPISCSHQRAVDYWTE 391
              :|. ..|..|..|..|.:..|. .|:|||   |:|            ..:.|||:|::..:.:
 Frog   222 RGSPDRSIGIQKPVGHIDIYPNGG-SFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFID 285

  Fly   392 TVY----PSNGNDFLAKRC--KRYSELLLGNYC-KNTNTVMGY 427
            ::.    ||     :|.||  |...|..|...| ||....:||
 Frog   286 SLLYEEKPS-----MAYRCNSKEAFEKGLCLSCRKNRCNTLGY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 83/288 (29%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 86/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.