DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and TTLL12

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_610325.1 Gene:TTLL12 / 35732 FlyBaseID:FBgn0033225 Length:626 Species:Drosophila melanogaster


Alignment Length:323 Identity:70/323 - (21%)
Similarity:130/323 - (40%) Gaps:73/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IFGIDHPYRMRSD-------QVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTK 156
            :..:.|.::...|       :.||.||....::.||||  :|...|...|.......::.|.   
  Fly   306 VLWLTHHFKNFEDFADRSPGKFINQFPFEYVITIKDLL--SIVGRRAAKEHHDSLTLETFPA--- 365

  Fly   157 LGIGGTRYKHLDIIPMTFVLPSDYQMFVEVFHRNPA----STWIVKPCSKSQGVGIYLVNKLSKL 217
                        .:|.|:.|.::.:.|...:....|    :.||:||.:.::|:..::.:.:.::
  Fly   366 ------------WLPTTYNLSTEVKEFAAYYQTRAAKGLDNHWIIKPWNLARGLDTHITDNIKQI 418

  Fly   218 KKFAYDARTFYPQINRDTCVISKYIDNPLLI------GGKKFDLRLFVLVTTFNPLKAYLYKEGF 276
            .:.....    |:|      ..|||:.|:|.      |..|||:|..:|:.:..|||||::::.|
  Fly   419 VRLPATG----PKI------AQKYIERPVLFSRQEVEGSVKFDIRYVILLKSVKPLKAYIHRKFF 473

  Fly   277 CRFCTEKYDETEIDNVFMHLTNVSIQKTNQEYNSIHGGK-------WPLQ---NLWLYLDSLRGE 331
            .||....:.....|:...|.|.::.|...|    :|..|       |..|   |.|..|:     
  Fly   474 LRFANHPFTLDHFDDYEKHYTVMNYQTEAQ----LHHVKCDDFLTLWQEQYPDNDWSALE----- 529

  Fly   332 GVSDMLWSRITATIRHSLDAVAPV-MANDRHCFEVYGYDIII------DNNLKPWLIEINTSP 387
               ..:.|.:...::.:..|..|. :|.......:|..||::      :..::|.|:|||.:|
  Fly   530 ---QQICSMLLEVLQCASQADPPCGLAPCAQSRALYAADIMLRWKDDKEKLMEPQLLEINWTP 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 69/315 (22%)
TTLL12NP_610325.1 ATP-grasp_4 328..613 CDD:302634 68/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.