DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and Ttll13

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001128434.1 Gene:Ttll13 / 308762 RGDID:1310399 Length:825 Species:Rattus norvegicus


Alignment Length:403 Identity:120/403 - (29%)
Similarity:194/403 - (48%) Gaps:76/403 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EWNFYWACTQNCRYIFGIDHPYRMRSDQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQ 149
            ||..||.   :|.  ..::....|:..|.|||||...|:.|||||.:|:.|.:|           
  Rat   117 EWTVYWT---DCS--VSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQK----------- 165

  Fly   150 SHPPDTKLGIGGTRYKHLDIIPMTFVLPSDYQMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKL 214
            .:|         |.|   :|.|.|:.||:||..|.....:....|:|.||.|..||.||::....
  Rat   166 LYP---------TEY---NIFPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTP 218

  Fly   215 SKLKKFAYDARTFYPQINRDTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRF 279
            .::|.             .:..:..:||..|.||.|.|||:|::||:|:.:||:.::|:||..||
  Rat   219 KEIKP-------------GEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARF 270

  Fly   280 CTEKYDE---TEIDNVFMHLTNVSIQKTNQEY--NSIHGGKWPLQ--NLWLYLDS-----LRGEG 332
            .|..|.|   ..::.|.|||||.:|.|.|:.:  :...|.|..|.  |.||...|     |.|: 
  Rat   271 ATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVRDDAVGSKRKLSTLNAWLREHSHDPRELWGD- 334

  Fly   333 VSDMLWSRIT---ATIRHSLDAVAP--VMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHST 392
            :.|::...|.   :.:||:.....|  :......|||:.|:||::|:.|||||:|:|.|||..:.
  Rat   335 IEDIIIKTIISAHSVLRHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTD 399

  Fly   393 TTNDRMLKSRLIDNVLDVVVPPNCMPNEHWDKTPNPELLKNFTVLMPISPCKPKEQV-PVRRKGR 456
            :..||.:|..|:.:.::::....|      ||....|..|.          :.||:: |..::.|
  Rat   400 SRLDREVKDALLCDAMNLINLRGC------DKKKVIEEEKR----------RVKERLFPCHQQPR 448

  Fly   457 LSKKKKSKSTTAS 469
            .:::::.:|:.|:
  Rat   449 EARREQLESSQAA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 105/328 (32%)
Ttll13NP_001128434.1 TTL 133..416 CDD:281171 104/319 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.