DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and Ttll5

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_038969237.1 Gene:Ttll5 / 299208 RGDID:1563583 Length:1328 Species:Rattus norvegicus


Alignment Length:391 Identity:128/391 - (32%)
Similarity:195/391 - (49%) Gaps:73/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NRLRPPKSRNGIYYSTDWDKSALV-SNFQKRGWLQVPSFNGEWNFYWACTQNCRYIFGIDH--PY 106
            |.:|....|..:.|......|.|| |.....|:.:|...:.::|..|..:          |  |:
  Rat    54 NNIRIIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGS----------HLKPF 108

  Fly   107 RMRS---DQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTKLGIGGTRYKHLD 168
            .:|:   .|.:||||.|.||:|||.|.|||.|           :..:|           .:|...
  Rat   109 LLRTLSEAQKVNHFPRSYELTRKDRLYKNIIR-----------MQHTH-----------GFKAFH 151

  Fly   169 IIPMTFVLPSDYQMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDARTFYPQINR 233
            |:|.||:||::|..|...:.:: ...|||||.:.|:|.|:||:|..:::..             .
  Rat   152 ILPQTFLLPAEYAEFCNSYSKD-RGPWIVKPVASSRGRGVYLINNPNQISL-------------E 202

  Fly   234 DTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDE--TEIDNVFMHL 296
            :..::|:||:|||||...|||:||:||||:::||..|||:||..||.|.:||:  ..|.|.||||
  Rat   203 ENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHL 267

  Fly   297 TNVSIQKTNQEYNSI-------HGGKWPLQNLWLYLDSLRGEG---------VSDMLWSRITATI 345
            ||.|:.|.:.:|.|.       :|.||.:..:..|   |:.||         |.|::...|.:..
  Rat   268 TNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRY---LKQEGKDTTALMAHVEDLIIKTIISAE 329

  Fly   346 RHSLDAVAPVMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDNVLDV 410
            .....|....:.:...|||:||:|::|||.|||||:|:|.|||:......|..:|:.:|.::..|
  Rat   330 LAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTV 394

  Fly   411 V 411
            |
  Rat   395 V 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 114/326 (35%)
Ttll5XP_038969237.1 TTL 117..395 CDD:397308 111/316 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.