DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and TTLL10

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001123517.1 Gene:TTLL10 / 254173 HGNCID:26693 Length:673 Species:Homo sapiens


Alignment Length:425 Identity:101/425 - (23%)
Similarity:174/425 - (40%) Gaps:94/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PPKSRNG-IYYSTDWDKSALVSNFQK-RGWLQV-PSFNGEWNFYWACTQNCRYIFGIDHPYRMRS 110
            |..:|.| .:|....:.:.::|::.| :||.:: .|...::...| |....|..:|   .:| ..
Human   150 PHSTRPGPFFYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKW-CEVKSRDSYG---SFR-EG 209

  Fly   111 DQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTKLGIGGTRYKH-----LDII 170
            :|::...||:..|:.|..|:..:         ||...|.|.......|:.....|.     |:.:
Human   210 EQLLYQLPNNKLLTTKIGLLSTL---------RGRARAMSKASKVPGGVQARLEKDAAAPALEDL 265

  Fly   171 PMTF--------------VLPSDYQM--------FVEVFHRNPASTWIVKPCSKSQGVGIYLVNK 213
            |.|.              ..|..|::        |..:|  :....||.||.:.:||.||:|:..
Human   266 PWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLF--DETQIWICKPTASNQGKGIFLLRN 328

  Fly   214 LSKLKKFAYDARTFY------------PQINRDTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNP 266
            ..::.......|:..            ||..    |:.:||.||||:.|:|||:|.::|:....|
Human   329 QEEVAALQAKTRSMEDDPIHHKTPFRGPQAR----VVQRYIQNPLLVDGRKFDVRSYLLIACTTP 389

  Fly   267 LKAYLYKEGFCRFCTEKYDETEIDNVFMHLTNVSIQKTNQEYNSI-HGGKWPLQNLWLYLDSLRG 330
            ...: :..|:.|.....||....| :..||||..:||.:..|..: ....|.:::|..|      
Human   390 YMIF-FGHGYARLTLSLYDPHSSD-LGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRY------ 446

  Fly   331 EGVSDMLW---------------SRITATIRHSLDAVAPVMANDRHCFEVYGYDIIIDNNLKPWL 380
              :||..|               .|:...:.|...|..|.:......|::.|.|.:||:|.|.||
Human   447 --ISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWL 509

  Fly   381 IEINTSPSMHSTTTNDRMLKS---RLIDNVLDVVV 412
            :|:|::|::|   ||..:||.   .::...||:|:
Human   510 LEMNSNPALH---TNCEVLKEVIPGVVIETLDLVL 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 88/364 (24%)
TTLL10NP_001123517.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..132
PHA03247 <9..99 CDD:223021
CPSase_L_D2 284..548 CDD:388419 72/277 (26%)
PRK07764 <568..673 CDD:236090
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.