DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and ttll-15

DIOPT Version :10

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_505663.3 Gene:ttll-15 / 187090 WormBaseID:WBGene00010630 Length:513 Species:Caenorhabditis elegans


Alignment Length:109 Identity:23/109 - (21%)
Similarity:41/109 - (37%) Gaps:27/109 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 VGQNGIQHSPQDVPKEVASITSQNENSLAEHHN--EKLVSESAMPIEKGPTRPAAMASVIGEMKK 287
            |.|:.:.:|.:.:......:.||.:..:.|..:  :||.||..    |.|.....:..|:|.|:.
 Worm    18 VQQSSLSNSVRWLHSSELDLKSQMQEIIPEQQDRLKKLKSEQG----KVPVGNITVDMVLGGMRG 78

  Fly   288 KVAA--KAKLLDSD-------------------SDTDREPLGSS 310
            ....  :..|||:|                   :::..|||..|
 Worm    79 MTGLLWETSLLDADEGIRFRGMSIPECQKILPSAESGEEPLPES 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:397308 23/109 (21%)
ttll-15NP_505663.3 CPSase_L_D2 133..411 CDD:473076
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.