DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and Ttl

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_612545.2 Gene:Ttl / 171572 RGDID:621113 Length:377 Species:Rattus norvegicus


Alignment Length:404 Identity:102/404 - (25%)
Similarity:179/404 - (44%) Gaps:86/404 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KSRNGIYYSTDWDKSALVSNFQKRGWLQVPSFN---GEWNFYWACTQNCRYIFG-IDHPYRMRSD 111
            :..|...|: :..:..|.:.:.||.....|.||   ||.|         |..|| :.|...:.  
  Rat     7 RDENSSVYA-EVSRLLLATGYWKRLRRDNPRFNLMLGERN---------RLPFGRLGHEPGLA-- 59

  Fly   112 QVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQS----------HPPDTKLGI----GGT 162
            |::|::..:.:|.||..|:|.:|        ....|::|          :|.:.|..:    .|.
  Rat    60 QLVNYYRGADKLCRKASLVKLVK--------TSPELSESCSWFPESYVIYPTNLKTPVAPAQNGI 116

  Fly   163 RYKHLDIIPMTFVLPSDYQMFVEVFHR----NPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYD 223
            :      :|::.....:.:.|:..::|    ...:.||.|..:.::|.||.:.::.|:|..|..:
  Rat   117 Q------LPVSNSRTDEREFFLASYNRKKEDGEGNVWIAKSSAGAKGEGILISSEASELLDFIDN 175

  Fly   224 ARTFYPQINRDTCVISKYIDNPLLI--GGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDE 286
            ....:        ||.||:::|||:  |.:|||:|.:|||.  :....|||:||..|..:|.|..
  Rat   176 QGQVH--------VIQKYLEHPLLLEPGHRKFDIRSWVLVD--HQYNIYLYREGVLRTASEPYHV 230

  Fly   287 TEIDNVFMHLTNVSIQKTNQEYNSIHGGKWPLQNLWL------YLDSLRGEGVSDMLWSRITATI 345
            ....:...||||..|||   ||:..: ||:...|...      ||.|.....:.:.:..:|...|
  Rat   231 DNFQDKTCHLTNHCIQK---EYSKNY-GKYEEGNEMFFEEFNQYLTSALNITLENSILLQIKHII 291

  Fly   346 RHSLDAVAPVMANDRH----CFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDN 406
            |..|.:|.|.::. :|    .|::.|:|.::|..||.||||:|.:|:.      .:.|.:.|...
  Rat   292 RSCLMSVEPAIST-KHLPYQSFQLLGFDFMVDEELKVWLIEVNGAPAC------AQKLYAELCQG 349

  Fly   407 VLDVVV-----PPN 415
            ::|:.:     ||:
  Rat   350 IVDIAISSVFPPPD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 87/344 (25%)
TtlNP_612545.2 TTL 81..366 CDD:397308 80/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.