DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL1A and TTLL9

DIOPT Version :9

Sequence 1:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001008409.1 Gene:TTLL9 / 164395 HGNCID:16118 Length:439 Species:Homo sapiens


Alignment Length:384 Identity:141/384 - (36%)
Similarity:206/384 - (53%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLITQPINGLHYIRNRLRPPKSRNGIYYSTDWDKSALVSNFQKRGWLQVPSFNGEWNFYWACTQN 95
            ||..|...|....:.:.|  :.|..|.:.|....:.:.....:.||::|.. .|||:|||.....
Human    21 KLQNQNYKGHGLSKGKER--EQRASIRFKTTLMNTLMDVLRHRPGWVEVKD-EGEWDFYWCDVSW 82

  Fly    96 CRYIFGIDHPYRMRSDQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTKLGIG 160
            .|..|  ||.| |.....|:||.|..||:||:.::||:||:||.|||....|..:          
Human    83 LRENF--DHTY-MDEHVRISHFRNHYELTRKNYMVKNLKRFRKQLEREAGKLEAA---------- 134

  Fly   161 GTRYKHLDIIPMTFVLPSDYQMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDAR 225
                 ..|..|.||.:|.:|.:|||.|.:||..|||:||.::|||.||:|..:|..:..:..|.|
Human   135 -----KCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTR 194

  Fly   226 TFYPQ---INRDTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDET 287
            :...|   |..:..|..:||:||.||||:|||||::|||.:       ::.|........:.|  
Human   195 SSDDQKDDIPVENYVAQRYIENPYLIGGRKFDLRVYVLVMS-------VFAECLLWSGHRRQD-- 250

  Fly   288 EIDNVFMHLTNVSIQKTNQEYNSIHGGKWPLQNLWLYLDSLRGEGVSDMLWSRITATIRHSLDAV 352
                  :|||||::|||:.:|:...|.||.||....||.|..|....:.|:..|......||.:|
Human   251 ------VHLTNVAVQKTSPDYHPKKGCKWTLQRFRQYLASKHGPEAVETLFRDIDNIFVKSLQSV 309

  Fly   353 APVMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDNVLDVV 411
            ..|:.:|:||||:|||||:||.:|||||:|:|.|||:.:::..|..||:.|:::.|.||
Human   310 QKVIISDKHCFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 119/308 (39%)
TTLL9NP_001008409.1 TTL 92..368 CDD:281171 117/305 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D315374at33208
OrthoFinder 1 1.000 - - FOG0001326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.