DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and CG6688

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:449 Identity:80/449 - (17%)
Similarity:139/449 - (30%) Gaps:175/449 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GSHHAGHGQNGAYSSKS------LPRESKRKEPLGQAYESIREK-DGEMLLIINEYGSPLGLTAL 349
            |..|:...::|.:...|      :||.:...|..|  ::..|.| |....:.....|:|..|..|
  Fly     6 GGFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYG--FQLTRSKWDPYPWVCEVAAGTPAALCGL 68

  Fly   350 PDKEHGGGLLVQHVEPGSRAERGRLRRDDRILEINGIKLIGLTESQVQEQLRRALESSELRVRVL 414
                          :||           |.:||:||..::||..|::.:.::    |.:..|.:|
  Fly    69 --------------KPG-----------DCVLEVNGNDVLGLRVSEIAKMVK----SQKDCVTIL 104

  Fly   415 RGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNGLGFSV 479
            ..:....:..|              |.....||:.|||     |:|...:|.:|:.         
  Fly   105 CWNSECDKDCD--------------TNSICCAPMPTSL-----RRLSLVLESILRL--------- 141

  Fly   480 TTRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAIL--------- 535
                    ..||:....|.|.....::|.|...|..:..:..|:.....|...|:|         
  Fly   142 --------VECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIA 198

  Fly   536 -------------RGMPAGATVRIVVSRQQELAEQ--------------------------ADQP 561
                         :.:.||.| |.||.||..:..|                          .|..
  Fly   199 NAFEMCRSENKLRQKLFAGIT-RPVVGRQDRITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNL 262

  Fly   562 AEKSAGVAVAPSVAPPA-----VPAAAAPAPPIPVQKSSSARSLFTHQQQSQLNESQHFIDAGSE 621
            :..:|...:..:....|     :||..:|....|.::::...:|                    :
  Fly   263 SPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERTTMHATL--------------------D 307

  Fly   622 SAASNDSLPPSSNSWHSREELTLHIPVHDTEKAGLGVSVKGKTCSNLNASGSSASSGSN 680
            :.|::.||  |:|               |.::.|:          ..||.|....||:|
  Fly   308 ANAAHPSL--STN---------------DLQQEGV----------KPNAEGVDEESGTN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492 15/70 (21%)
CRS1_YhbY <390..>436 CDD:294440 7/45 (16%)
PDZ_signaling 462..548 CDD:238492 17/107 (16%)
PDZ_signaling <686..753 CDD:238492
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 23/110 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.