DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and Zasp66

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:390 Identity:82/390 - (21%)
Similarity:131/390 - (33%) Gaps:114/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 PTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNGLGFSVTTRDNPAGGHCPIYIKNILPRGAA 503
            ||.||...|:.:..:..::..|.:::..   .....:|..|   .:||.|.        |.||..
  Fly    33 PTPKPPLVPLPSPCRRRSSSGLKKRVHF---ADEQNVGVQV---GSPAHGE--------LLRGDI 83

  Fly   504 IEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEKSAGV 568
            |        .::.|.|...:   :..|...:.||  ||..:|:||.|..::|  ..|.|.:.||.
  Fly    84 I--------SKIGEYDARDL---SHADAQQLFRG--AGNEIRLVVHRDNKIA--YTQGATQEAGP 133

  Fly   569 A---------VAPSVAPPAVPAAAAPAP-------PIPVQKSSSARSLFTHQQQSQLNES----- 612
            .         |.|.:.|...|:...|.|       .:||  .:..:::|     .|||.|     
  Fly   134 GSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPV--DTLPQTVF-----PQLNSSGGYEV 191

  Fly   613 -----------QHFIDAGSESAASNDS--------LP--------PSSNSW---HSREELTLHIP 647
                       .|..|...|.||..:.        ||        |::.|:   :....:..| |
  Fly   192 PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAH-P 255

  Fly   648 VHDTEKAGLGVSVKGKTCSNL--NASGSSASSGSNGLMKHDGDLGIFVKNVIHGG-------AAS 703
            .||...:    .:|.:....:  ...||.|.:|.....:.:..:|::..|.|...       |.|
  Fly   256 GHDYHDS----IMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATS 316

  Fly   704 RDGRLRMNDQLL------SVNGVSLRGQNNAEAMETLRR-----AMVNTPGKHPGTITLLVGRKI 757
            ...||:  |..|      .:||.....|.:....||.|.     ...|.....|..:|:.|..|:
  Fly   317 ESNRLK--DSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKV 379

  Fly   758  757
              Fly   380  379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492
CRS1_YhbY <390..>436 CDD:294440
PDZ_signaling 462..548 CDD:238492 17/85 (20%)
PDZ_signaling <686..753 CDD:238492 18/84 (21%)
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 16/70 (23%)
DUF4749 285..359 CDD:292558 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.