DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and Stxbp4

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:544 Identity:117/544 - (21%)
Similarity:187/544 - (34%) Gaps:143/544 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 IDAGSESAASNDSLPPSSNSWHSREELTLHIPVHDTEKAGLGVSVKGKTCSNLNASGSSASSGSN 680
            :|.|:.||.|:..|        .|:.....|.|  .::.|||:.:.|                  
  Rat     1 MDIGTSSARSSSPL--------ERDPAFRVITV--AKETGLGLKILG------------------ 37

  Fly   681 GLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGK- 744
            |:.:::|.| :::..|..||...:||||:..|||:|:|..|:.|.:..||...|.||.:..... 
  Rat    38 GIDRNEGPL-VYIHEVTPGGDCYKDGRLKPGDQLVSINKESMIGVSFEEAKNILTRAKLRWESPL 101

  Fly   745 ------------HPGTITLLVGRKILRSASSSDILDHSNSHSHSHSNSSGGSNSNGSGNNNNSSS 797
                        |||.|       ..:|...|:..:...|..:..|:.:|......|     |:.
  Rat   102 EIAFIRQKSYCGHPGNI-------CCQSPPVSEDCEPQTSAFNLLSSPAGTLLPKTS-----STP 154

  Fly   798 NASDN--SGATVIYLSPEKREQRCNGGGGGGSAGNEMNRWSN----PVLDRLTGGICSSNSAQPS 856
            ...|:  ...|||...||..:.   |.....|..|.....||    |.......|.....|..||
  Rat   155 RTQDSILPSCTVIQTQPEHSQA---GLAPVPSLNNRPTDTSNADIAPAWTDDASGPQGKISLNPS 216

  Fly   857 SQQSHQQQP--------HPSQQQQQQRRLPAAPVCSSAALRNESYYMATNDNWSPAQMHLMTAHG 913
            ::...::..        .|:::|.:             |||.:   :..:...:.:....:....
  Rat   217 ARLKAEKLEMALNYLGIQPTKEQHE-------------ALRQQ---VQADSEGTVSFGDFVQVAR 265

  Fly   914 NTALLIEDDAEPMSPTLPARPHDGQHCNTSSANPSQNLAVGNQGPPINTVPGTPSTSSNFDATYS 978
            |...|..|:.......||            |...||.|..|                 :.:|...
  Rat   266 NLFCLQLDEVNVGDHELP------------SVLDSQLLPCG-----------------SLEADEV 301

  Fly   979 SQLSLETNSGVEHFSRDALGRRSI-SEKHHAALDARETGTYQRNKKLREE-RERERRIQLTKSAV 1041
            .:|..|.|:.:|  .||||..:.: ||||...|........|..|.:.|| |....||.|.::|.
  Rat   302 GRLRQERNAALE--ERDALKEKLLESEKHRKQLIEELQNVKQEAKAVAEETRALRSRIHLAEAAQ 364

  Fly  1042 ---------YGGSIESLTARIASANAQFSGY--KHAKTASSIEQRETQQQLAAAEAE-ARDQLGD 1094
                     |...|..|.|.::...|:.:.|  ::.::...:.:|.|.......::| ||...  
  Rat   365 RQARGMEMDYEEVIRLLEAEVSELKARLADYSDQNKESVQDLRKRVTVLDCQLRKSEMARKTF-- 427

  Fly  1095 LGPSLGMKKSSSLESLQTMVQELQ 1118
                     .||.|.|...|:.:|
  Rat   428 ---------KSSTERLLRFVEAIQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492
CRS1_YhbY <390..>436 CDD:294440
PDZ_signaling 462..548 CDD:238492
PDZ_signaling <686..753 CDD:238492 25/79 (32%)
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 27/93 (29%)
TPR_MLP1_2 299..400 CDD:285204 28/102 (27%)
GBP_C <306..389 CDD:303769 25/84 (30%)
coiled coil 359..369 CDD:293879 2/9 (22%)
coiled coil 378..389 CDD:293879 3/10 (30%)
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.