DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and Cytip

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:334 Identity:71/334 - (21%)
Similarity:113/334 - (33%) Gaps:117/334 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 VLRG----DRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLG------RKIEIM 467
            ||.|    :.|||.|   .:|:  .|||:...||        .|.:|.:..||      ||: :.
Mouse    29 VLTGQLTMEDNRRIQ---VLAD--TVATLPRGRK--------QLALARSSSLGDFSWSQRKV-VT 79

  Fly   468 LKKGPNG-LGFSVTT---------------------RDNPAGGHCPIYIKNILPRGAAIEDGRLK 510
            ::|..|| .||.:.|                     .|:||  ||                ..|:
Mouse    80 VEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPA--HC----------------AGLQ 126

  Fly   511 PGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVR----IVVSRQQEL---AEQADQPAEKS--- 565
            .||....|:|....|.|...||.::|......|:.    .::.|:.||   .:...|..:|.   
Mouse   127 VGDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELEAKLQTLKQTLKKKWVE 191

  Fly   566 -------------AGVAVAPSVAPPAVPAAA------APAPPI----PVQKSSSARSLFTHQQQS 607
                         ...|.:|::....:..::      .|:|.:    .:...||.:|..      
Mouse   192 LRSLHLQEQRLLHGDTANSPNLENMDLDESSLFGNLLGPSPALLDRHRLSSESSCKSWL------ 250

  Fly   608 QLNESQHFIDA--GSESAASNDSLPPSSNSWHSREELTLHIPVHDTEKAGLGVSVKGKTCSNLNA 670
                |...:|:  |..|:.|.||:..:.:...|.::...|        :..|..:.....|..|.
Mouse   251 ----SSLTVDSEDGYRSSMSEDSIRGAFSRQTSTDDECFH--------SKDGDEILRNASSRRNR 303

  Fly   671 SGSSASSGS 679
            |.|..||||
Mouse   304 SISVTSSGS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492
CRS1_YhbY <390..>436 CDD:294440 9/26 (35%)
PDZ_signaling 462..548 CDD:238492 24/111 (22%)
PDZ_signaling <686..753 CDD:238492
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 23/103 (22%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.