DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and mpz-4

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_500654.1 Gene:mpz-4 / 177255 WormBaseID:WBGene00019165 Length:402 Species:Caenorhabditis elegans


Alignment Length:271 Identity:57/271 - (21%)
Similarity:92/271 - (33%) Gaps:73/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RKEPLGQAYESIREKDGEMLLIINEYGSPLGLTALPDKEHGGGLLVQHVEPGSRAERGRLRRDDR 379
            |.||:..:|:.:.|...|  |...:..:.|||.    ..||....|.:..|    .:|.:...|.
 Worm    46 RGEPVPNSYKMLVEATFE--LPKKDKITQLGLV----NRHGLVTRVHYASP----FKGAILPGDI 100

  Fly   380 ILEINGIKLIGLTESQVQEQLRRALESSELRVRVLRGDRNRRQQRDSKVAEMVEVATVSPTRKPH 444
            ||::|| ..:...|.|:.|.:......:.|:               |.|..:....|.:|..:|.
 Worm   101 ILQVNG-TTVSFDEKQLTEHVDETTGGASLQ---------------SNVKTVKRKPTTTPKTEPV 149

  Fly   445 AAP----------VGTSLQVANTRKL-----GRKIEIMLKKGPNG-------------------- 474
            .||          ||..|...:..|:     ..|..:...|.|||                    
 Worm   150 RAPHSLYPDFKVVVGKILNSKSETKITVLVARLKNRMSTSKIPNGILATQDHTIDLAILYQFKYL 214

  Fly   475 -LGFSVTTRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILR-G 537
             ||.:|...|.      .:.:...:|  .::....|..|:.::.||..|:  .|..|.....| |
 Worm   215 QLGLNVQQVDR------KVVVNYTIP--DSVSHCSLNIGEAIIAVDDKPI--NTLADNRQRFREG 269

  Fly   538 MPAGATVRIVV 548
            ..|...:|::|
 Worm   270 FEANGWIRLLV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492 17/70 (24%)
CRS1_YhbY <390..>436 CDD:294440 6/45 (13%)
PDZ_signaling 462..548 CDD:238492 21/107 (20%)
PDZ_signaling <686..753 CDD:238492
mpz-4NP_500654.1 PDZ <81..130 CDD:381812 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.