Sequence 1: | NP_001036283.1 | Gene: | baz / 32703 | FlyBaseID: | FBgn0000163 | Length: | 1520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500654.1 | Gene: | mpz-4 / 177255 | WormBaseID: | WBGene00019165 | Length: | 402 | Species: | Caenorhabditis elegans |
Alignment Length: | 271 | Identity: | 57/271 - (21%) |
---|---|---|---|
Similarity: | 92/271 - (33%) | Gaps: | 73/271 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 RKEPLGQAYESIREKDGEMLLIINEYGSPLGLTALPDKEHGGGLLVQHVEPGSRAERGRLRRDDR 379
Fly 380 ILEINGIKLIGLTESQVQEQLRRALESSELRVRVLRGDRNRRQQRDSKVAEMVEVATVSPTRKPH 444
Fly 445 AAP----------VGTSLQVANTRKL-----GRKIEIMLKKGPNG-------------------- 474
Fly 475 -LGFSVTTRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILR-G 537
Fly 538 MPAGATVRIVV 548 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
baz | NP_001036283.1 | DUF3534 | <62..174 | CDD:288873 | |
PDZ_signaling | 341..412 | CDD:238492 | 17/70 (24%) | ||
CRS1_YhbY | <390..>436 | CDD:294440 | 6/45 (13%) | ||
PDZ_signaling | 462..548 | CDD:238492 | 21/107 (20%) | ||
PDZ_signaling | <686..753 | CDD:238492 | |||
mpz-4 | NP_500654.1 | PDZ | <81..130 | CDD:381812 | 11/53 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |