DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and LOC100535100

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:XP_021328841.1 Gene:LOC100535100 / 100535100 -ID:- Length:355 Species:Danio rerio


Alignment Length:368 Identity:86/368 - (23%)
Similarity:143/368 - (38%) Gaps:66/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 MLKKGPNGLGFSVTTRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDV 531
            ::|||.||.||.:.......|.    ||:.: .|.:..|...|:.|||::||:|..:..:|...|
Zfish    11 VMKKGENGYGFHLHGEKGKTGQ----YIRKV-ERASPAEASGLRAGDRVVEVNGENVERETHHQV 70

  Fly   532 VAILRGMPAGATVRIVVSRQQELAEQADQPAEKSAGVAVAPSVAPPAVPAAAAPAPPIPVQKSSS 596
            |..::.:.....:.:|.....|..........:...:..:|:...|      .|:|....|.:.|
Zfish    71 VQRIKAVEHETRLLVVDRETDEYFRSLRLTCTEEMAIRTSPTATTP------LPSPSTSKQGNGS 129

  Fly   597 ARSLFTHQQQSQLNESQHFIDAGSESAASNDSLPPSSNSWHSREELTLHIPVHDTEKAGLGVSVK 661
            .         |:.:|....|......|...|..|.|.:|.....||...:........|.|.   
Zfish   130 V---------SKRSEISKPIRKPPSRALKKDVQPSSESSTRDPSELVPRLCFLVRSDTGYGF--- 182

  Fly   662 GKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQN 726
                 ||::..|..              |.:::.:..|..|.|.| |:..|:|:.||||::....
Zfish   183 -----NLHSEKSKP--------------GQYIRALDPGSPADRAG-LKPQDRLIEVNGVNIESMR 227

  Fly   727 NAEAMETLRRAMVNTPGKHPGTITLLVG-------RKILRSASSSDILD------HSNSHSHSHS 778
            :||.:     |.:...||.  |..|:|.       :|:..:.:|..:.|      :.:|..|.:.
Zfish   228 HAEVV-----AFIKNGGKE--TRLLVVDPDTDEHFKKMNITPTSIHVKDFDESITNGSSSPHVNG 285

  Fly   779 NSSGGSNSNGSGNNNN---SSSNASDNSGATVIYLSPEKREQR 818
            .||..::|:||..:||   |||:..|....|.:.|||...|.:
Zfish   286 TSSRSTHSDGSSQDNNVQYSSSHLLDPFEETGLNLSPTAAEAK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492
CRS1_YhbY <390..>436 CDD:294440
PDZ_signaling 462..548 CDD:238492 22/80 (28%)
PDZ_signaling <686..753 CDD:238492 19/66 (29%)
LOC100535100XP_021328841.1 PDZ_signaling 11..86 CDD:238492 22/79 (28%)
EBP50_C 90..>184 CDD:312529 19/116 (16%)
PDZ_signaling 168..247 CDD:238492 24/108 (22%)
EBP50_C 251..355 CDD:312529 21/78 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.