DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment baz and SYNJ2BP-COX16

DIOPT Version :9

Sequence 1:NP_001036283.1 Gene:baz / 32703 FlyBaseID:FBgn0000163 Length:1520 Species:Drosophila melanogaster
Sequence 2:NP_001189476.1 Gene:SYNJ2BP-COX16 / 100529257 HGNCID:48350 Length:191 Species:Homo sapiens


Alignment Length:166 Identity:44/166 - (26%)
Similarity:67/166 - (40%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 EIMLKKGPNGLGFSVT--TRDNPAGGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKT 527
            ||.|.:||:||||::.  |..........||:..|...|||..||||:.||::|.|:|..:....
Human    13 EINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLL 77

  Fly   528 QTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEKSAGVAVAPSVAPPAVPAAAAPAPPIPVQ 592
            ..|.|.:.|......::|:    |..|..|......:..|       .|..:|......|..   
Human    78 HQDAVDLFRNAGYAVSLRV----QHRLQVQNGPIGHRGEG-------DPSGIPIFMVLVPVF--- 128

  Fly   593 KSSSARSLFTHQQQSQLNESQHFIDAGSESAASNDS 628
                |.::...:.:.:|.|::  |...||.....||
Human   129 ----ALTMMDPELEKKLKENK--ISLESEYEKIKDS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bazNP_001036283.1 DUF3534 <62..174 CDD:288873
PDZ_signaling 341..412 CDD:238492
CRS1_YhbY <390..>436 CDD:294440
PDZ_signaling 462..548 CDD:238492 29/84 (35%)
PDZ_signaling <686..753 CDD:238492
SYNJ2BP-COX16NP_001189476.1 PDZ_signaling 13..97 CDD:238492 29/87 (33%)
DegQ <16..77 CDD:223343 23/60 (38%)
COX16 <133..173 CDD:290843 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.