DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and MIX17

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_013715.1 Gene:MIX17 / 855014 SGDID:S000004604 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:57/169 - (33%)
Similarity:86/169 - (50%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQ 68
            |.|.:|.|.|  |:.|.|.|:.:...|||..:      ....|...|.||:|...  .:||.||.
Yeast     3 RSRGSSRPIS--RSRPTQTRSASTMAAPVHPQ------QQQQPNAYSHPPAAGAQ--TRQPGMFA 57

  Fly    69 QMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQPY----YAQQQQPNEP 129
            |||:||.||||||.||||:|.|:|.:|||||         :.:||..||..    .:.|.|.::.
Yeast    58 QMASTAAGVAVGSTIGHTLGAGITGMFSGSG---------SDSAPVEQQQQNMANTSGQTQTDQQ 113

  Fly   130 QG-ACAWELKQFIQCA-QGQADLTLCEGFNEALRQCKQS 166
            .| .|..:.:.|.:|. :...:..:|:.:.:.|:.|:::
Yeast   114 LGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQEA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 6/32 (19%)
MIX17NP_013715.1 CHCH 118..152 CDD:399611 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I2014
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - oto99408
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
TreeFam 1 0.960 - -
1211.810

Return to query results.
Submit another query.