DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and AT5G09570

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_196519.1 Gene:AT5G09570 / 830816 AraportID:AT5G09570 Length:139 Species:Arabidopsis thaliana


Alignment Length:168 Identity:43/168 - (25%)
Similarity:64/168 - (38%) Gaps:49/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQQ 69
            |||     |.|.:.|..||:|.|...   .|||.||         :|.||:.|       |....
plant     8 GRS-----SYRPSRPAAARSPPPQSV---NRAPPPA---------TAQPSSGG-------SFLGN 48

  Fly    70 MAAT-AGGVA--VGSAIGHTVGHGLTSLFSGSGDKE--AAAPAPAAAAPAPQQPYYAQQQQPNEP 129
            :.|: ..|:|  .|:|.||.|   :.|:......|.  ..:..|:||                ..
plant    49 IGASITEGLAWGTGTAFGHRV---VDSVMGPRTFKHETVVSQVPSAA----------------NT 94

  Fly   130 QGACAWELKQFIQCAQG-QADLTLCEGFNEALRQCKQS 166
            ..||....|.|..|... .:|::.|:.:.:.|.:||::
plant    95 MTACDIHSKAFQDCVNHFGSDISKCQFYMDMLSECKKN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 8/32 (25%)
AT5G09570NP_196519.1 CHCH 98..132 CDD:399611 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.