DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Zbed5

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_898911.2 Gene:Zbed5 / 71970 MGIID:1919220 Length:756 Species:Mus musculus


Alignment Length:153 Identity:75/153 - (49%)
Similarity:91/153 - (59%) Gaps:16/153 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMP--APQQPSMFQQMAATAGG 76
            |.|...:..|||....||  .||||      ...|.:|.|||||.|  ||:||.:..|||.||.|
Mouse     9 TSRVTLLAGRAPQMRAAP--RRAPA------AQPPAAAAPSAVGSPAAAPRQPGLMAQMATTAAG 65

  Fly    77 VAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQPYYAQQQQPNEPQGACAWELKQFI 141
            ||||||:|||:||.:|..|||.|..|.|.|....     |:|..||.|. .:..|.|:.|:|||:
Mouse    66 VAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITY-----QEPQGAQLQN-QQSFGPCSLEIKQFL 124

  Fly   142 QCAQGQADLTLCEGFNEALRQCK 164
            :|||.|:|:.|||||||.||||:
Mouse   125 ECAQNQSDVKLCEGFNEVLRQCR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/32 (66%)
Zbed5NP_898911.2 CHCH 116..147 CDD:284221 20/30 (67%)
DUF4371 <335..407 CDD:290989
Dimer_Tnp_hAT 671..736 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43080
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.