DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and gpat3

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001008432.1 Gene:gpat3 / 493261 XenbaseID:XB-GENE-993435 Length:154 Species:Xenopus tropicalis


Alignment Length:172 Identity:82/172 - (47%)
Similarity:102/172 - (59%) Gaps:21/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVG--MPAPQQ 63
            |.|..||     .|.|.||..:||||..|||       |.|:.| |||::..|||:|  ..||:|
 Frog     1 MPRGSRS-----RTSRVAPPASRAPAMRPAP-------PPAAHP-PAPVAQAPSALGPAAAAPRQ 52

  Fly    64 PSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPA-AAAPAPQQPYYAQQQQPN 127
            |.:..|||.||.|||||||:|||:||.:|..|.|.   .:|.||.| .....|.||.|.||||  
 Frog    53 PGLMAQMATTAAGVAVGSAVGHTIGHAITGGFGGG---SSAEPARADITYQEPAQPMYQQQQQ-- 112

  Fly   128 EPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169
            .....|.:|:|||::|||.|:||.|||||.|.|:||:.::.|
 Frog   113 SQYTPCQYEMKQFLECAQNQSDLKLCEGFGEVLKQCRFANGL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 20/31 (65%)
gpat3NP_001008432.1 CHCH 118..151 CDD:310983 20/32 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4957
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49449
Inparanoid 1 1.050 135 1.000 Inparanoid score I4457
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm48209
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.