DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and chchd10

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_957078.1 Gene:chchd10 / 393757 ZFINID:ZDB-GENE-040426-1753 Length:143 Species:Danio rerio


Alignment Length:151 Identity:72/151 - (47%)
Similarity:89/151 - (58%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQQMAATAGGVAVG 80
            |:.|    :||||.||..:.||||||    |.||:..|:|.   .|:||.:..|||.||.|||||
Zfish     6 RSRP----SPAPASAPAPSYAPAPAA----PPPMAVAPAAA---QPKQPGLMAQMATTAAGVAVG 59

  Fly    81 SAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQPYYAQQQQPNEPQGACAWELKQFIQCAQ 145
            ||:||.:|..:|..|||....||..|||.         |....:.|....|.|.:|::||:.||.
Zfish    60 SAVGHVMGSAITGAFSGGSSSEAPKPAPT---------YQEPSRLPPSQSGPCLFEVRQFLDCAT 115

  Fly   146 GQADLTLCEGFNEALRQCKQS 166
            .||||:|||||||||:|||.|
Zfish   116 TQADLSLCEGFNEALKQCKLS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/31 (68%)
chchd10NP_957078.1 CHCH 103..134 CDD:284221 20/30 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4415
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm25224
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.