DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Chchd10

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001007009.1 Gene:Chchd10 / 361824 RGDID:1359417 Length:138 Species:Rattus norvegicus


Alignment Length:173 Identity:76/173 - (43%)
Similarity:93/173 - (53%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPS 65
            |.|..|||:..|::|         ||..||       .|..|||.|||.::          .||.
  Rat     1 MPRGSRSAAARPASR---------PAHPPA-------HPPPSAPAPAPATS----------GQPG 39

  Fly    66 MFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAP----APAAAAPAPQQPYYAQQQQP 126
            :..|||:||.|||||||:||.:|..|||.||| |..|.|.|    |||..|..|.|         
  Rat    40 LMAQMASTAAGVAVGSAVGHVMGSALTSAFSG-GSSEPAQPAVQQAPARPASHPLQ--------- 94

  Fly   127 NEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169
               .|.||:|:|||:.|:..|:||||||||:|||:|||.:|.|
  Rat    95 ---MGPCAYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/31 (68%)
Chchd10NP_001007009.1 CHCH 98..131 CDD:284221 22/32 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm45146
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.