DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and CG31007

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster


Alignment Length:194 Identity:69/194 - (35%)
Similarity:96/194 - (49%) Gaps:48/194 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGRSASPPPS------TRRTAPVQARAPA-------PA---PAPVQTRAPAPAASAPVPAPMSAP 52
            |.||..|..:      :.|::.|.|..|:       ||   |......|.||||||........|
  Fly     3 RQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGP 67

  Fly    53 PSAVGMPAPQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQ 117
            .:|         ..|:.||.||.|||.|||:||.||.|||.:|.|.|.          ||||.:|
  Fly    68 STA---------DRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQ----------AAPAKEQ 113

  Fly   118 PYY-------AQQQQPNEPQ----GACAWELKQFIQCAQ-GQADLTLCEGFNEALRQCKQSHHL 169
            |..       |.|..| :||    |.||:||:||::|.: ..:||::|:.||||::||::.:::
  Fly   114 PQQEGSLAASASQSVP-KPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCRRRYNV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 16/32 (50%)
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.