DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Chchd2

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001015019.1 Gene:Chchd2 / 316643 RGDID:1309819 Length:154 Species:Rattus norvegicus


Alignment Length:176 Identity:80/176 - (45%)
Similarity:98/176 - (55%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMP--APQQ 63
            |.|..||     .|.|..|..:|||....||.:    ||||..|..|   |.|||||.|  ||:|
  Rat     1 MPRGSRS-----RTSRVTPPASRAPQMRAAPRR----APAAQPPATA---AAPSAVGSPAAAPRQ 53

  Fly    64 PSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAP-----APAAAAPAPQQPYYAQQ 123
            |.:..|||.||.|||||||:|||:||.:|..|||..:.|.|.|     .|..|....||.:    
  Rat    54 PGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGANAEPARPDITYQEPQGAPLQNQQSF---- 114

  Fly   124 QQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL 169
                   |.|:.|:|||::|||.|:|:.|||||||.||||:.::.|
  Rat   115 -------GPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/31 (68%)
Chchd2NP_001015019.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339856
Domainoid 1 1.000 128 1.000 Domainoid score I5194
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49449
Inparanoid 1 1.050 128 1.000 Inparanoid score I4570
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - otm45146
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.