DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and Zbed5

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001099394.1 Gene:Zbed5 / 288622 RGDID:1559988 Length:757 Species:Rattus norvegicus


Alignment Length:158 Identity:75/158 - (47%)
Similarity:91/158 - (57%) Gaps:25/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMP--APQQPSMFQQMAATAGG 76
            |.|..|:..|||....||.:    ||||..|..|   |.|||||.|  ||:||.:..|||.||.|
  Rat     9 TSRVTPLAGRAPQMRAAPRR----APAAQPPATA---AAPSAVGSPAAAPRQPGLMAQMATTAAG 66

  Fly    77 VAVGSAIGHTVGHGLTSLFSGSGDKEAAAP-----APAAAAPAPQQPYYAQQQQPNEPQGACAWE 136
            ||||||:|||:||.:|..|||..:.|.|.|     .|..|....||.:           |.|:.|
  Rat    67 VAVGSAVGHTLGHAITGGFSGGANAEPARPDITYQEPQGAPLQNQQSF-----------GPCSLE 120

  Fly   137 LKQFIQCAQGQADLTLCEGFNEALRQCK 164
            :|||::|||.|:|:.|||||||.||||:
  Rat   121 IKQFLECAQNQSDVKLCEGFNEVLRQCR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 21/32 (66%)
Zbed5NP_001099394.1 CHCH 117..148 CDD:284221 20/30 (67%)
DUF4371 <312..408 CDD:290989
Dimer_Tnp_hAT 673..737 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45146
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.