DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and SPAC6C3.02c

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_593716.1 Gene:SPAC6C3.02c / 2543292 PomBaseID:SPAC6C3.02c Length:172 Species:Schizosaccharomyces pombe


Alignment Length:172 Identity:63/172 - (36%)
Similarity:85/172 - (49%) Gaps:20/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPAPQQPSMFQ 68
            |.|||:|||  ||.||.::.:.| |..|.:|.||.||.|....||   ||:||  .....|..|.
pombe     3 RRRSAAPPP--RRAAPARSASTA-AALPPRTMAPPPAPSRVQQAP---PPTAV--QGGSSPGFFG 59

  Fly    69 QMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAA----PAPAAAAPAPQQPY-------YAQ 122
            .:.:||.||.:|||||||||..:|..|||||...|.|    |..:.:...|:..|       :|.
pombe    60 NLVSTAAGVGIGSAIGHTVGSVITGGFSGSGSNNAPADTSVPQSSYSNSVPEAAYGSAPPSTFAS 124

  Fly   123 QQQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCK 164
            .....|.:.||..:.|.|..|. .:.:.:.|..:.|.|:.|:
pombe   125 SAISEEAKNACKGDAKMFADCI-NEHEFSQCSYYLEQLKACQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 8/32 (25%)
SPAC6C3.02cNP_593716.1 COG3416 <22..142 CDD:225950 46/125 (37%)
CHCH 135..165 CDD:284221 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2087
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1756
OMA 1 1.010 - - QHG54220
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - oto100998
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.