DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chchd2 and har-1

DIOPT Version :9

Sequence 1:NP_573196.1 Gene:Chchd2 / 32701 FlyBaseID:FBgn0260747 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_497826.1 Gene:har-1 / 175529 WormBaseID:WBGene00007630 Length:154 Species:Caenorhabditis elegans


Alignment Length:171 Identity:81/171 - (47%)
Similarity:102/171 - (59%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRA---PAPAASAPVPAPMSAP-PSAVGMPAP 61
            |||| |:|||.||    |||::   ||.||...:.|   |.|||:||...|.:|| |....|.||
 Worm     1 MVRR-RTASPSPS----APVRS---APRPAAQSSFAAPPPRPAAAAPAYHPPAAPTPMGAPMGAP 57

  Fly    62 QQ-PSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAP--APQQPYYAQQ 123
            .| |.:.:||||||||||:|||:||.||    .:|:|.|...|.....|||||  |||...|:| 
 Worm    58 SQGPGLMKQMAATAGGVAIGSAVGHAVG----GMFTGGGSSHAEQAPAAAAAPAGAPQASGYSQ- 117

  Fly   124 QQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCK 164
                    .|.:|.:||:.|||.|:|::||.|||:..:|||
 Worm   118 --------PCEFEWRQFVDCAQNQSDVSLCNGFNDIFKQCK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chchd2NP_573196.1 CHCH 133..165 CDD:284221 17/32 (53%)
har-1NP_497826.1 COG3416 <7..>90 CDD:225950 46/93 (49%)
CHCH 119..152 CDD:284221 17/32 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5074
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I3307
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 1 1.010 - - D1611117at2759
OrthoFinder 1 1.000 - - FOG0001898
OrthoInspector 1 1.000 - - oto17502
orthoMCL 1 0.900 - - OOG6_103181
Panther 1 1.100 - - LDO PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 1 1.000 - - X1616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.